PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_014229
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 132aa    MW: 14570.2 Da    PI: 9.1073
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_014229genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY46.57.1e-15781191658
                  TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
         WRKY  16 kgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                   +  + rs Y+Ct+++Cpvkk ver+  d++v ei+Y+g+Hn 
  DCAR_014229  78 DDGYNLRSRYKCTHSNCPVKKIVERAL-DGQVPEIVYKGQHNL 119
                  566678*********************.*************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081110.01675122IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.6E-1175122IPR003657WRKY domain
SuperFamilySSF1182906.67E-1175122IPR003657WRKY domain
SMARTSM007742.5E-777121IPR003657WRKY domain
PfamPF031065.2E-1080118IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MITKFTGSQP QNQLEYPSSA APAVSFPQFT ASVSTTSAYQ QMLTSVPDHS LLKQSSQLSQ  60
SDDMRSQPSS STVDKPADDG YNLRSRYKCT HSNCPVKKIV ERALDGQVPE IVYKGQHNLE  120
RPQANKHRKD I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619961.13e-33PREDICTED: probable WRKY transcription factor 4
RefseqXP_016442380.13e-33PREDICTED: probable WRKY transcription factor 4
SwissprotQ9ZQ702e-20WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA5AYL03e-33A5AYL0_VITVI; Putative uncharacterized protein
TrEMBLF6HYH95e-33F6HYH9_VITVI; Putative uncharacterized protein
TrEMBLQ5IY476e-33Q5IY47_VITVI; DNA binding protein WRKY2
STRINGVIT_01s0011g00220.t012e-32(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.12e-21WRKY DNA-binding protein 3